Host taxon 10090
Protein NP_001165272.1
triple QxxK/R motif-containing protein
Mus musculus
Gene Triqk, UniProt B2B9E1
>NP_001165272.1|Pseudomona aeruginosa PA01|triple QxxK/R motif-containing protein
MGRKDSSNTKLPVDQYRKQIGKQDYKKTKPILRATKLKAEAKKTAIGIKEVGLMLAAILALLLAFYAFFYLRLSTNIDSDLDLDED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.89 | -1.88671367706965 | 0.043 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)