Host taxon 10090
Protein NP_783579.1
tripartite motif-containing 30B
Mus musculus
Gene Trim30b, UniProt Q8BY96
>NP_783579.1|Pseudomona aeruginosa PA01|tripartite motif-containing 30B
MQHANSYRRNLQISEIYHFVVLGYPTIGTGEQYLEVDMSRSDAWLLGLNHGPHAAPQLCSMNEMFPNVKFHDTDIQHETYQSKYGYWIIGMKYRSVYAFDKCPVTYNSVSWPSLCLVLSVMLEFSCPGKLGLSHFMMFLPMKLSSIGSMTLPSLIRSIF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.55 | 2.55394220186256 | 0.0028 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)