Host taxon 10090
Protein NP_080191.3
transmembrane protein 88
Mus musculus
Gene Tmem88, UniProt Q9D0N8
>NP_080191.3|Pseudomona aeruginosa PA01|transmembrane protein 88
MAEVPGAQRPVLAGGPEPRDPLDCWACAVLVTAQNLLVAVFNLLLLALVLGTILLPAVIMLGFGFLCHSQFLRSQAPLCTSHLRDPGFTALLVTGFLLLVPLLVLALATYRRLCLRLRLADCLVPYSRALYRRRRIPQPKQIPVSPGSRSVPTPGKVWV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.75 | 0.751555330415491 | 0.023 | 32071273 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)