Host taxon 10090
Protein NP_001135422.1
transmembrane protein 80 isoform 1
Mus musculus
Gene Tmem80, UniProt Q9D3H0
>NP_001135422.1|Pseudomona aeruginosa PA01|transmembrane protein 80 isoform 1
MLFHLSGLYSALYFLATLLMIVYKSQVFSYPCNCLALDLVLLLLMGILKVAQLYLGTKGNLMEAEVPLAASLAFTAVGGLLSVHFLLWQTLVLWMDSVLSTVLLVLHGLEAGLQVVVIADFIR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.46 | -2.46195937370133 | 1.3e-8 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)