Host taxon 10090
Protein NP_001092789.1
transmembrane protein 35B precursor
Mus musculus
Gene Tmem35b, UniProt Q3U0Y2
>NP_001092789.1|Pseudomona aeruginosa PA01|transmembrane protein 35B precursor
MSFRVGVLRVLLGVFFALTGAAKLFQVSAPVSQQMRALFEQFAEVFPLKVFGYQPDPISYQTAVGWLELLAGLLLVVGPPVLQEISNVLLILLMMGAVFTLVVLKEPLSTYVPAAVCLGLLLLLDSCHFLARTKGAVRCPSKKIPPAHGN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.26 | -2.25562427118069 | 0.0057 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)