Host taxon 10090
Protein NP_080515.1
transmembrane protein 35A
Mus musculus
Gene Tmem35a, UniProt Q9D328
>NP_080515.1|Pseudomona aeruginosa PA01|transmembrane protein 35A
MASPRTITIMALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALVFGILLTCRLLIARKPEDRSSEKKALPESAEEQPSLYEKAPQGKVKVS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.51 | -2.50927479361818 | 0.039 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)