Host taxon 10090
Protein NP_001157088.1
transmembrane protein 273 precursor
Mus musculus
Gene Tmem273, UniProt E9PVZ2
>NP_001157088.1|Pseudomona aeruginosa PA01|transmembrane protein 273 precursor
MSSGVPLLRVLLFLLGIGGAQVLATGKPAETEIDFKYAIIGMAVGVAISAGFLALKICMIRRHLSDNDSADLKNTPQDTILLKKKSPRDAREIEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -4.29 | -4.2883539980648 | 0.001 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)