Host taxon 10090
Protein NP_001311444.2
transmembrane protein 251 isoform 2
Mus musculus
Gene Tmem251, UniProt Q8BH26
>NP_001311444.2|Pseudomona aeruginosa PA01|transmembrane protein 251 isoform 2
MMNFRQRMGWIGVGLYLLASAAAFYYVFEINETYNRLALEHILQHPEEPREGTTWTHSLKARLLSLPFWLWTIIFLIPYLQMFLFLYSCTRADPKTVGYCIIPICLAVICNRHQAFVKASNQISRLQLIDT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.28 | 1.27646565672929 | 0.00087 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)