Host taxon 10090
Protein NP_079762.1
transmembrane protein 208 isoform 3
Mus musculus
Gene Tmem208, UniProt Q9CR96
>NP_079762.1|Pseudomona aeruginosa PA01|transmembrane protein 208 isoform 3
MAPKGKVGTRGKKQIFEENKETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWMALGFSLAVYGASYHSMSSMARASFSEDGSLMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYIWSFWLLAPGRALYLLWVNVLGPWFTADSGAPAPELNEKRQRRQERRQMKRL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.43 | -1.43095218301286 | 6.7e-6 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)