Host taxon 10090
Protein NP_742046.2
transmembrane protein 18
Mus musculus
Gene Tmem18, UniProt Q3TUD9
>NP_742046.2|Pseudomona aeruginosa PA01|transmembrane protein 18
MSSAYSVRSFPVSIPAVIMETDWTEPWLLGLLAFHLLCLLLTCFSSQRYKLQIGHFLCLVVLVYSAEYINEVAAVNWRLFSKYQYFDSRGMFISLVFSAPLLFNAMLIVIMWVRKTLTVMTDLKTLQEERKERRRRRKEE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.15 | -2.14500400905427 | 5.9e-15 | 32071273 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)