Host taxon 10090
Protein NP_001091741.1
transmembrane protein 176A
Mus musculus
Gene Tmem176a, UniProt Q9DCS1
>NP_001091741.1|Pseudomona aeruginosa PA01|transmembrane protein 176A
MSTDMETAVVGKVDPEAPQPTHIDVHIHQESALAKLLLAGCSLLRIPASASTQSQGSSRVLVASWVVQTVLGALSVVLGGTLYIGHYLAMYSEGAPFWTGIVAMLAGAVAFLHKKRGGTCWALMRTLLVLASFCTAVAAIVIGSRELNFYWYFLGDDVCQRDSSYGWSTMPRTTPVPEEADRIALCIYYTSMLKTLLMSLQAMLLGIWVLLLLASLTPVCVYIWKRFFTKAETEEKKLLGAAVI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.17 | -1.16911478965035 | 7.5e-24 | 32071273 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)