Host taxon 10090
Protein NP_079663.1
transmembrane protein 14C isoform 1
Mus musculus
Gene Tmem14c, UniProt Q9CQN6
>NP_079663.1|Pseudomona aeruginosa PA01|transmembrane protein 14C isoform 1
MQKDSGPLMPLHYFGFGYAALVATGGIIGYAKAGSVPSLAAGLFFGGLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYNSGKFMPAGLIAGASLLMVAKVGISLLSSPHP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.45 | -1.4520465362107 | 0.00077 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)