Host taxon 10090
Protein NP_759015.2
transmembrane protein 125
Mus musculus
Gene Tmem125, UniProt Q8CHQ6
>NP_759015.2|Pseudomona aeruginosa PA01|transmembrane protein 125
MSQQASVGRGLPPDVLAEQVELWWSQQPRRSLLCFSVAVILVAGCGAGGVALLSSTSSRSGEWRLAVGTVLCLLALLVLVKQLMSSAVQDMNCIRQAQHVALLRSGGGADAVVVLLSGFVLLVTGLTLAGLAAAPAPARPLAAMLSVGITLASLGSVLLLGLLLYQVGVSGHCPPICTEAFSAQNGHGDNSSIFSISGQLSSGQRHETTSSIASLI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.27 | 1.27124341826658 | 7.1e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)