Host taxon 10090
Protein NP_775655.1
transmembrane protein 11, mitochondrial isoform 1
Mus musculus
Gene Tmem11, UniProt Q8BK08
>NP_775655.1|Pseudomona aeruginosa PA01|transmembrane protein 11, mitochondrial isoform 1
MAAWGRRRLGPGGGGSRERVSLSATDCYIVHEIYSGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKVYELYAV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.43 | 1.42724816585401 | 1.6e-12 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)