Host taxon 10090
Protein NP_001239082.1
transmembrane protein 106C
Mus musculus
Gene Tmem106c, UniProt Q80VP8
>NP_001239082.1|Pseudomona aeruginosa PA01|transmembrane protein 106C
MGSQHSSALTFCQRKKDDNPEDLLADRDQEEAIAQFPYVEFTGRNSITCHTCQGAGYIPAEQVNELVALIPHSDQRLRPQRTKQYVLLSVLLCLLASGLVFFFLFPHSVLVDDNGIKVTKVTFNEQDSLVVLDVTATLKIRNSNFYPVAVTNLFSQVQYMKAVVGSYTTTNVSLIAPRSEHLVNFTVKAEVGGPSSYVYFYCTLPAIRVHNIVIFMRTSVKISYIGHISQSTLETQHYVDCGVNSTAAQSLFLVPRGPHL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.92 | -1.91584650217541 | 0.00016 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)