Host taxon 10090
Protein NP_080709.1
transmembrane protein 100
Mus musculus
Gene Tmem100, UniProt Q9CQG9
>NP_080709.1|Pseudomona aeruginosa PA01|transmembrane protein 100
MTEESTKENLGAPKSPTPVTMEKNPKREVVVTTGPLVSEVQLMAATGGAELSCYRCIIPFAVVVFITGIVVTAVAYSFNSHGSIISIFGLVLLSSGLFLLASSALCWKVRQRNKKVKRRESQTALVVNQRCLFA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.36 | -0.36044462064784 | 2.5e-9 | 32071273 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)