Host taxon 10090
Protein NP_666372.1
transmembrane inner ear expressed protein precursor
Mus musculus
Gene Tmie, UniProt Q8K467
>NP_666372.1|Pseudomona aeruginosa PA01|transmembrane inner ear expressed protein precursor
MAGRQHGSGRLWALGGAALGACLAGVATQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVVGIFSLFVLSIIITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEIPGEDKKKKKKDSVDTVAIKVEEDEKNEAKKKGEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.09 | -2.08535277825328 | 0.013 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)