Host taxon 10090
Protein NP_080487.2
transmembrane emp24 domain-containing protein 9 precursor
Mus musculus
Gene Tmed9, UniProt Q99KF1
>NP_080487.2|Pseudomona aeruginosa PA01|transmembrane emp24 domain-containing protein 9 precursor
MAAVRGVRVVGSSPGLLLGRGMRAFLLLLWLAARGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.53 | 0.531765320617968 | 0.00028 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)