Host taxon 10090
Protein NP_079636.2
transmembrane emp24 domain-containing protein 3 precursor
Mus musculus
Gene Tmed3, UniProt Q78IS1
>NP_079636.2|Pseudomona aeruginosa PA01|transmembrane emp24 domain-containing protein 3 precursor
MVHEAPHASSFQMLLQLLLLLLLRAEPLRSAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPRGNVIYRETKKQYDSFTYKTEAKGVYRFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPVNRAVHS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.26 | -1.26124897461609 | 5.9e-9 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)