Host taxon 10090
Protein NP_081622.1
translational activator of cytochrome c oxidase 1
Mus musculus
Gene Taco1, UniProt Q8K0Z7
>NP_081622.1|Pseudomona aeruginosa PA01|translational activator of cytochrome c oxidase 1
MMSWAAASLRMTAVPCFRVRCLGFRVGPWGASQHANPGCGAAPHRTLHVSATASAGHNKWSKVRHIKGPKDMERSRIFSKLTLSIRLAVKEGGPNPENNSSLANILELCRSKNMPKSTIESALKTEKNKGIYLLYEGRGPGGSSLLIEALSNSGPKCHLDIKYILNKNGGMMAEGARHFFDKKGVVVVGVEDREKKAVNLERALELAIEAGAEDVKEAEDEEEKNLFKFICDASSLHQVRKKLDSLGLCPVSCSMEFIPHSKVQLAEPELEQAAHLIQALNNYEDVIHVYDNIE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.58 | -2.58291804753003 | 7.6e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)