Bacterial taxon 208964
Protein WP_002553999.1
translation initiation factor IF-1
Pseudomona aeruginosa PA01
Gene infA, UniProt P65116
>WP_002553999.1|Pseudomona aeruginosa PA01|translation initiation factor IF-1
MSKEDSFEMEGTVVDTLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVRVELTPYDLSKGRITYRAR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ 1.36 | 1.36059564186807 | 5.2e-46 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)