Host taxon 10090
Protein NP_081207.1
transcriptional and immune response regulator
Mus musculus
Gene Tcim, UniProt Q9D915
>NP_081207.1|Pseudomona aeruginosa PA01|transcriptional and immune response regulator
MKAKPSHQATSMSSSLRVSPSIHGYHFDTAARKKAVGNIFENIDQESLQRLFRNSGDKKAEERAKIIFAIDQDLEEKTRALMALKKRTKDKLLQFLKLRKYSIKVH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.96 | -0.956883603844746 | 2.1e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)