Bacterial taxon 208964
Protein WP_003108028.1
transcription termination/antitermination protein NusG
Pseudomona aeruginosa PA01
Gene nusG, UniProt Q9HWC4
>WP_003108028.1|Pseudomona aeruginosa PA01|transcription termination/antitermination protein NusG
MAKRWYVVHAYSGYEKHVMRSLIERVKLAGMEEEFGEILVPTEEVVEMRNGQKRKSERKFFPGYVLVQMEMNEGTWHLVKDTPRVMGFIGGTADKPAPITDREADAILRRVADSGDKPKPKTLFEPGETVRVIDGPFADFNGVVEEVNYEKSRIQVAVLIFGRSTPVELEFSQVEKV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ 0.8 | 0.798497141058584 | 2.5e-32 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)