Host taxon 10090
Protein NP_079720.1
transcription initiation factor TFIID subunit 13
Mus musculus
Gene Taf13, UniProt P61216
>NP_079720.1|Pseudomona aeruginosa PA01|transcription initiation factor TFIID subunit 13
MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.74 | 0.736141616810429 | 0.034 | 32071273 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)