Host taxon 10090
Protein NP_079855.2
transcription initiation factor TFIID subunit 12
Mus musculus
Gene Taf12, UniProt Q8VE65
>NP_079855.2|Pseudomona aeruginosa PA01|transcription initiation factor TFIID subunit 12
MNQFGPSALINLSSFSSVKPEPASTPPQGSMANSTTVGKIAGTPGTGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.24 | -1.24331181064202 | 0.0004 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)