Host taxon 10090
Protein NP_064408.2
transcription initiation factor TFIID subunit 10
Mus musculus
Gene Taf10, UniProt Q8K0H5
>NP_064408.2|Pseudomona aeruginosa PA01|transcription initiation factor TFIID subunit 10
MSCSGSGADPEAATACAASVAGPAPLVSAPAALPTSTAAESKASPAGTAGGPVAGVATAGTGPVAARAGEPAERRGPASVAAGGAAPPEGAMSNGVYALPSAANGEVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.9 | -0.89654652775774 | 0.0054 | 32071273 | |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)