Host taxon 10090
Protein NP_001034608.1
transcription initiation factor IIA subunit 2 isoform 1
Mus musculus
Gene Gtf2a2, UniProt Q80ZM7
>NP_001034608.1|Pseudomona aeruginosa PA01|transcription initiation factor IIA subunit 2 isoform 1
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.8 | 0.796411017476225 | 0.00012 | 32071273 | |
Retrieved 1 of 4 entries in 1.9 ms
(Link to these results)