Host taxon 10090
Protein NP_035842.1
transcription elongation factor A protein-like 9
Mus musculus
Gene Tceal9, UniProt Q9DD24
>NP_035842.1|Pseudomona aeruginosa PA01|transcription elongation factor A protein-like 9
MKPCQKMEGNLEKEDEPKPEEEPKPEEKPEEGQEPEEEEKSEETFRERLIRSLQDFQEDIHNRHLSSDDLFRDVEELDEIRKVRNKLIVTRWKANRSHPYPYLM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.11 | -1.10755383098022 | 2.0e-12 | 32071273 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)