Host taxon 10090
Protein NP_001162050.1
transcription elongation factor A protein-like 8
Mus musculus
Gene Tceal8, UniProt Q9CZY2
>NP_001162050.1|Pseudomona aeruginosa PA01|transcription elongation factor A protein-like 8
MQKSCDENEGTPQNTPKADEGHPSEDPPQQAGETLQASGENVREETEGSHRGEPAEPSPEPKEDTPARHLNPEEVIRGVDELERLREEIRRVRNKFVLMHWKQRHSRSRPYPVCFRP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.88 | -0.880546390662465 | 0.00084 | 32071273 | |
Retrieved 1 of 1 entries in 10.4 ms
(Link to these results)