Host taxon 10090
Protein NP_778174.1
transcription and mRNA export factor ENY2
Mus musculus
Gene Eny2, UniProt Q9JIX0
>NP_778174.1|Pseudomona aeruginosa PA01|transcription and mRNA export factor ENY2
MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.98 | 0.98370558178105 | 2.0e-5 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)