Host taxon 10090
Protein NP_001318110.1
trafficking protein particle complex subunit 6A isoform b
Mus musculus
Gene Trappc6a, UniProt Q78XR0
>NP_001318110.1|Pseudomona aeruginosa PA01|trafficking protein particle complex subunit 6A isoform b
MADAVLFEFLHTEMVAELWAPDPDPGSGGKRRSLSVLEGLGFRVGQALGERLPLETPAFREELDALKFLCRDLWAAMFQKHMDGLRTNHQGTYVLQDNSFPLLVTMGSGPQYLEEAPKFLAFTCGLLCGALHTLGFQSLVTASVASLPACRLEAGAHRLWGGHMCFRQGNERAGRVPGGGTIP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.35 | -1.3479919422146 | 0.019 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)