Host taxon 10090
Protein NP_001300651.1
trafficking protein particle complex subunit 2 isoform 2
Mus musculus
Gene Trappc2, UniProt Q9CQP2
>NP_001300651.1|Pseudomona aeruginosa PA01|trafficking protein particle complex subunit 2 isoform 2
MSGSFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNECLQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.09 | -1.08913972994923 | 0.0085 | 32071273 | |
Retrieved 1 of 3 entries in 1.9 ms
(Link to these results)