Host taxon 10090
Protein NP_001019377.1
trafficking protein particle complex subunit 1
Mus musculus
Gene Trappc1, UniProt Q5NCF2
>NP_001019377.1|Pseudomona aeruginosa PA01|trafficking protein particle complex subunit 1
MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLSFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVEFVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.13 | -1.12592299439696 | 0.011 | 32071273 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)