Host taxon 10090
Protein NP_001157544.1
TRAF family member-associated NF-kappa-B activator isoform 2
Mus musculus
Gene Tank, UniProt P70347
>NP_001157544.1|Pseudomona aeruginosa PA01|TRAF family member-associated NF-kappa-B activator isoform 2
MDKNIGEQLNRAYEAFRQACMDRDSAVRELQQKTENYEQRIREQQEQLSFQQNLIDRLKSQLLLVDSSRDNSYGYVPLLEDSDRRKNNLTLDEPHDKVKLGTLRDKQSKVRRQEVSSGKESAKGLNIPLHHERDNIEKTFWDLKEEFHRICLLAKAQKDHLSKLNIPDIATDTQCSVPIQCTDKTEKQEALFKPQAKDDINRGMSCVTAVTPRGLGRDEEDTSFESLSKFNVKFPPMDNDSIFLHSTPEAPSILAPATPETVCQDRFNMEVRDNPGNFVKTEETLFEIQGIDPITSAIQNLKTTDKTNPSNLRATCLPAGDHNVFYVNTFPLQDPPDAPFPSLDSPGKAVRGPQQPFWKPFLNQDTDLVVPSDSDSELLKPLVCEFCQELFPPSITSRGDFLRHLNTHFNGET
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.58 | 1.57850457935152 | 7.4e-26 | 32071273 | |
Retrieved 1 of 5 entries in 1.1 ms
(Link to these results)