Host taxon 10090
Protein NP_001258504.1
TP53-target gene 5 protein
Mus musculus
Gene Trp53tg5, UniProt Q9D976
>NP_001258504.1|Pseudomona aeruginosa PA01|TP53-target gene 5 protein
MSPSTKKRPRDKVPSKMQDEKLQDKITQHVSKVIERNRLKMVLKNLSLLKLFKSSNSRIQELHKLARRCWNSMLRVPKILQISSRDKDKVKQNNIKFQEIRVLEMRPNSKKAESVKEPKQKTSKKWKPKQGSKGSPAAVTWRKKQETFKISKVIKSGGLQARAQKRKTYVKKPRVVFLKTYHHSTTMGKMKALDITDQLVWFEGLPTRIHIPGRRIMCRSSTYRCLKRSCTRFCCASL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.57 | 1.56985485076643 | 0.032 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)