Host taxon 10090
Protein NP_001153652.1
interferon alpha responsive protein isoform a
Mus musculus
Gene Tor1aip2, UniProt Q9ER81
>NP_001153652.1|Pseudomona aeruginosa PA01|interferon alpha responsive protein isoform a
MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKKIHDSRVAGFNPALQLILSRTDKTLNKKLGQSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.67 | 1.66728817606047 | 2.0e-146 | 32071273 | |
Retrieved 1 of 2 entries in 1.5 ms
(Link to these results)