Host taxon 10090
Protein NP_081470.2
TM2 domain-containing protein 2 precursor
Mus musculus
Gene Tm2d2, UniProt Q8R0I4
>NP_081470.2|Pseudomona aeruginosa PA01|TM2 domain-containing protein 2 precursor
MVLGGCPVSYLLLCGQAALLLGNLLLLHCVSRSHSFNATAELDLTPSGAAHLEGPAASSWEYSDPNSPVILCSYLPDEFVDCDAPVDHVGNATASQELGYGCLKFGGQAYSDVQHTAVQCRALEGIECASPRTFLRENKPCIKYTGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLMPSDGSNWCTVY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.42 | -0.421811851842072 | 0.037 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)