Host taxon 10090
Protein NP_001170910.1
TLD domain-containing protein 2
Mus musculus
Gene Tldc2, UniProt E9PZS3
>NP_001170910.1|Pseudomona aeruginosa PA01|TLD domain-containing protein 2
MKGWQWRYTQLPTEMEDTLSGEEGEEEEEEEPAPAPAPQDPVEPQLTEASQVLGASEIKQLSLHLPPRVTGHPWSLVFCTSRDGFSLRRLYRQMEGHSGPVLLLLRDQDGQMFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGHNSFFVKGDLDSLMMGSGSGQFGLWLDGDLYHGGSYPCATFNNEVLARREQFCIKELEAWVLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.58 | 2.57594037939907 | 1.8e-14 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)