Host taxon 10090
Protein NP_001278165.1
TLC domain-containing protein 1 isoform c
Mus musculus
Gene Tlcd1, UniProt Q99JT6
>NP_001278165.1|Pseudomona aeruginosa PA01|TLC domain-containing protein 1 isoform c
MRWPWDLSRGARTGLPLAIPITGEQTPRISPDSVWKTTQPRTAVGNPSLWQTPEMLVEIETAWSASGYLLVCFSAGYFIHDTVDIVVSKQTRASWEYLVHHVMAMGAFFSGIFWKRFVGGGVLTLLVEVSNIFLTLRMMMKINNAQDLLLYKVNKYINLVMYFLFRLAPQAYLTKFFLQYAGQRTLGTFLLAILLMLDLMIIIYFSRLLRSDFCPERAPRRQQKDKFLTE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.13 | 1.12872971006444 | 1.5e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)