Host taxon 10090
Protein NP_035706.1
tissue factor pathway inhibitor isoform a precursor
Mus musculus
Gene Tfpi, UniProt O54819
>NP_035706.1|Pseudomona aeruginosa PA01|tissue factor pathway inhibitor isoform a precursor
MTYKMKKEYAFWATVCLLLSLVPEFLNALSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVKIQRRKAPFVKVVYESIN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.67 | -0.672962509548449 | 0.00099 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)