Host taxon 10090
Protein NP_067253.1
thymosin beta-4
Mus musculus
Gene Tmsb4x, UniProt P20065
>NP_067253.1|Pseudomona aeruginosa PA01|thymosin beta-4
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.23 | -0.234749207805657 | 3.7e-5 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)