Host taxon 10090
Protein NP_001034481.1
thymosin beta-10
Mus musculus
Gene Tmsb10, UniProt Q6ZWY8
>NP_001034481.1|Pseudomona aeruginosa PA01|thymosin beta-10
MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.29 | -1.29193785697302 | 0.0077 | 32071273 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)