Host taxon 10090
Protein NP_001295415.1
threonylcarbamoyladenosine tRNA methylthiotransferase isoform 2
Mus musculus
Gene Cdkal1, UniProt Q91WE6
>NP_001295415.1|Pseudomona aeruginosa PA01|threonylcarbamoyladenosine tRNA methylthiotransferase isoform 2
MPSASCDVLLDDIEDIISQEDSKPQDRQFSRKHVFPKVRRRNTQKYLQEEPRPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITAQSGTESSLGAMELIHHPVRTVLHSVRCRVLKTPLILLVVWW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.45 | -0.449588024994084 | 0.0098 | 32071273 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)