Bacterial taxon 208964
Protein WP_003097300.1
threonylcarbamoyl-AMP synthase
Pseudomona aeruginosa PA01
Gene tsaC, UniProt Q9I7A5
>WP_003097300.1|Pseudomona aeruginosa PA01|threonylcarbamoyl-AMP synthase
MISSFRAQCAARVVREGGVIAYPTEAVWGLGCDPWNEDAVYRLLALKARPVEKGLIVVAANIHQLDFLLEDLPDVWLDRLAGTWPGPNTWLVPHQERLPEWVTGVHDSVAVRVTDHPLVQELCHLTGPLISTSANPAGRPAARTRLRVEQYFHDELDAILGGALGGRRNPSLIRDLVTGQVIRPA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ 0.95 | 0.946171647875805 | 2.1e-21 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)