Host taxon 10090
Protein NP_084116.1
thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3
Mus musculus
Gene Tstd3, UniProt Q9D0B5
>NP_084116.1|Pseudomona aeruginosa PA01|thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3
MLARLVLGTSGRAALGSVEPALGGLKSIWRCSQAFCSTPKGVTYRELKSLLNSKDIMLIDVRNTLEILEQGKIPGSINIPLDEVGEALQMNPVDFKEKYCQVKPSKSDRLVFSCLAGVRSKKAMDTAISLGFNSAQHYAGGWKEWVTYEISEEKQES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.83 | -1.83218759886636 | 0.009 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)