Host taxon 10090
Protein NP_783577.2
thioredoxin-like protein 4B
Mus musculus
Gene Txnl4b, UniProt Q8BUH1
>NP_783577.2|Pseudomona aeruginosa PA01|thioredoxin-like protein 4B
MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSADLSKMAAIYLVDVDHTPVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNVPKYDLLYQDI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1 | 1.00272007903141 | 0.001 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)