Host taxon 10090
Protein NP_079575.1
thioredoxin-like protein 4A isoform a
Mus musculus
Gene Txnl4a, UniProt P83877
>NP_079575.1|Pseudomona aeruginosa PA01|thioredoxin-like protein 4A isoform a
MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.61 | 0.611394205537525 | 1.9e-6 | 32071273 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)