Host taxon 10090
Protein NP_742051.1
thioredoxin domain-containing protein 9
Mus musculus
Gene Txndc9, UniProt Q9CQ79
>NP_742051.1|Pseudomona aeruginosa PA01|thioredoxin domain-containing protein 9
MEGNGSVDMFSEVLENQFLQAAKLVENHLDSEIQKLDQIGEDELELLKEKRLAALRKAQQQKQEWLSKGHGEYREIGSERDFFQEVKESEKVVCHFYRDTTFRCKILDRHLAILAKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALLRDGKTQDYVVGFTDLGNTDDFTTETLEWRLGCSDVINYSGNLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSDDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.69 | 0.694430565392425 | 6.4e-6 | 32071273 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)