Host taxon 10090
Protein NP_780361.2
THAP domain-containing protein 3 isoform 1
Mus musculus
Gene Thap3, UniProt Q8BJ25
>NP_780361.2|Pseudomona aeruginosa PA01|THAP domain-containing protein 3 isoform 1
MPKSCAARQCCNRYSSRRKQLTFHRFPFSRPELLREWVLNIGRADFKPKQHTVICSEHFRPECFSAFGNRKNLKHNAVPTVFAFQNPTEVCPEVGAGGDSSGRNMDTTLEELQPPTPEGPVQQVLPDREAMEATEAAGLPASPLGLKRPLPGQPSDHSYALSDLDTLKKKLFLTLKENKRLRKRLKAQRLLLRRTCGRLRAYREGQPGPRARRPAQGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.32 | -2.32206037672441 | 6.4e-7 | 32071273 | |
Retrieved 1 of 3 entries in 0.5 ms
(Link to these results)