Host taxon 10090
Protein NP_778195.1
tctex1 domain-containing protein 4
Mus musculus
Gene Tctex1d4, UniProt Q8CDY7
>NP_778195.1|Pseudomona aeruginosa PA01|tctex1 domain-containing protein 4
MACRTLPSRRQEEETTKDLALKLPPGKPGGHLPSIDETRPIGPGPASRRGSLPGLHPSFSRRNSLAGPLVGPGGRRPSLGPVPPLGSRVSFSGLPLMLPRRMAPSYRLEPAPGEHWEAAGAQRALEAALTTQLNGVCYCGSEAGKLVQALCEQIHTRVRELNLPRYKLVCNVVLGPREGQGVHVVSRALWDAVHDGLASATFTNPSLFAVATVHAVYWE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.36 | -1.36360884453001 | 0.03 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)